Obatmelancarkanbab.com
Visit obatmelancarkanbab.comGlobal rank | - |
---|---|
Daily visitors | - |
Daily pageviews | - |
Pageviews per user | 0 |
Rating | |
---|---|
Status | Offline |
Latest check |
Countable Data Brief
Obatmelancarkanbab.com is tracked by us since November, 2015. Over the time it has been ranked as high as 11 567 099 in the world. It was owned by several entities, from Zafran Alhanan of Zafran Digital to REDACTED FOR PRIVACY of REDACTED FOR PRIVACY, it was hosted by Google Inc., ren yan ran and others. While CV. Rumahweb Indonesia was its first registrar, now it is moved to Jiangsu Bangning Science & technology Co. Ltd..
Obatmelancarkanbab has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Obatmelancarkanbab.com is poorly ‘socialized’ in respect to any social network. According to Siteadvisor and Google safe browsing analytics, Obatmelancarkanbab.com is quite a safe domain with no visitor reviews.
Worldwide Audience
Compare it to ...It seems that traffic on this site is too low to be displayed, sorry.
Traffic Analysis
Compare it to ...It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.
Subdomains Traffic Shares
Obatmelancarkanbab.com has no subdomains with considerable traffic.
SEO Stats
Compare it to ...Obatmelancarkanbab.com is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.
0
Google PR-
Yandex CYHomepage Top Backlinks PR
obatdarahtinggitanpaefeksampingg.wordpress.com | 0 |
obatkankergetahbening.blogspot.com | 0 |
Top Keywords % of search traffic
No data
Domain Registration Data
Compare it to ...Obatmelancarkanbab.com domain is owned by REDACTED FOR PRIVACY and its registration expires in 1 year.
General Get more Obatmelancarkanbab.com whois history
REDACTED FOR PRIVACY Owner since October 09, 2022 |
||
---|---|---|
1 year ago Expired on February 27, 2023 |
2 years old Created on February 27, 2022 |
2 years ago Changed at February 27, 2022 |
Registrar and Status
Registar | JIANGSU BANGNING SCIENCE & TECHNOLOGY CO. LTD. |
Status |
ok |
In Other TLDs
No data
Server Information
Compare it to ...Obatmelancarkanbab.com is hosted by ren yan ran.
IP Whois Get more Obatmelancarkanbab.com server history
-
ren yan ran
-
23.235.146.99
IP address
Server Technologies
-
Nginx
Backend server
DNS Records
Nameservers
- a.share-dns.com
- b.share-dns.net
- ns1.gname.net
- ns2.gname.net
host | value | ttl |
---|---|---|
obatmelancarkanbab.com | 216.239.38.21 |
14400 |
obatmelancarkanbab.com | 216.239.34.21 |
14400 |
obatmelancarkanbab.com | 216.239.32.21 |
14400 |
obatmelancarkanbab.com | 216.239.36.21 |
14400 |
host | value | ttl |
---|---|---|
obatmelancarkanbab.com | nsid3.rumahweb.biz |
86400 |
obatmelancarkanbab.com | nsid4.rumahweb.org |
86400 |
obatmelancarkanbab.com | nsid2.rumahweb.net |
86400 |
obatmelancarkanbab.com | nsid1.rumahweb.com |
86400 |
host | value | ttl |
---|---|---|
obatmelancarkanbab.com | Mname: nsid1.rumahweb.com |
86400 |
Safety
Compare it to ...Safety status of Obatmelancarkanbab.com is described as follows: Google Safe Browsing reports its status as safe.
Get more Obatmelancarkanbab.com reviews
MyWOT
Overall reputation | Unknown |
---|---|
Trustworthiness | Unknown |
Privacy | Unknown |
Child safety | Unknown |
Google Safe Browsing
Website status | Safe |
---|---|
Status | ok |
User reviews
Reputation | Unknown | |
---|---|---|
0 positive0 negative |
Social Engagement
Compare it to ...Obatmelancarkanbab.com has 0% of its total traffic coming from social networks (in last 3 months) and the most active engagement is detected in Facebook (3 shares)
Social Metrics Get more Obatmelancarkanbab.com social history
0%
of total traffic in last 3 months is social0
Facebook likes3
Facebook shares0
Twitter mentions0
Google pluses0
LinkedIn mentions0
Pinterest pins0
StumbleUpon views