Rishikeshraftingcampingadventures.com
Visit rishikeshraftingcampingadventures.comRishikesh River Rafting Camping I River Rafting & Camping in Rishikesh – Just another WordPress site
Global rank | - |
---|---|
Daily visitors | - |
Daily pageviews | - |
Pageviews per user | 0 |
Rating | |
---|---|
Status | Offline |
Latest check |
Countable Data Brief
Rishikeshraftingcampingadventures.com is tracked by us since November, 2016. Over the time it has been ranked as high as 1 049 699 in the world, while most of its traffic comes from India, where it reached as high as 61 663 position. It was owned by several entities, from Ashok Biswas of BUSINESS to ******** ******** (see Notes section below on how to view unmasked data) of BUSINESS, it was hosted by GoDaddy.com LLC.
Rishikeshraftingcampingadventures has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Rishikeshraftingcampingadventures.com is poorly ‘socialized’ in respect to any social network. According to Siteadvisor and Google safe browsing analytics, Rishikeshraftingcampingadventures.com is quite a safe domain with no visitor reviews.
Worldwide Audience
Compare it to ...Rishikeshraftingcampingadventures.com gets 100% of its traffic from India where it is ranked #147246.
Top Countries
India | 100.0% |
Top Ranks
India | 147 246 |
Traffic Analysis
Compare it to ...It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.
Subdomains Traffic Shares
Rishikeshraftingcampingadventures.com has no subdomains with considerable traffic.
SEO Stats
Compare it to ...Rishikeshraftingcampingadventures.com is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.
0
Google PR-
Yandex CYMetadata Updates Get more Rishikeshraftingcampingadventures.com metadata updates
Homepage Top Backlinks PR
No data
Top Keywords % of search traffic
No data
Domain Registration Data
Compare it to ...Rishikeshraftingcampingadventures.com domain is owned by ******** ******** (see Notes section below on how to view unmasked data) Business and its registration expires in 5 years.
General Get more Rishikeshraftingcampingadventures.com whois history
******** ******** (see Notes section below on how to view unmasked data) Business Owner since May 13, 2018 |
||
---|---|---|
5 years ago Expired on October 13, 2018 |
7 years old Created on October 13, 2016 |
6 years ago Changed at June 27, 2017 |
Registrar and Status
Registar | GODADDY.COM, LLC |
Status |
clientDeleteProhibited clientRenewProhibited clientTransferProhibited clientUpdateProhibited |
In Other TLDs
No data
Similar Domain Names
Server Information
Compare it to ...Rishikeshraftingcampingadventures.com uses WordPress CMS and is hosted by GoDaddy.com, LLC.
IP Whois Get more Rishikeshraftingcampingadventures.com server history
-
GoDaddy.com, LLC
-
166.62.28.131
IP address
Server Technologies
-
Apache HTTP Server
Backend server -
WordPress
CMS
DNS Records
Nameservers
- pdns09.domaincontrol.com
- pdns10.domaincontrol.com
host | value | ttl |
---|---|---|
rishikeshraftingcampingadventures.com | 166.62.28.131 |
10800 |
host | value | ttl | pri |
---|---|---|---|
rishikeshraftingcampingadventures.com | mail.rishikeshraftingcampingadventures.com |
3600 | 0 |
host | value | ttl |
---|---|---|
rishikeshraftingcampingadventures.com | pdns09.domaincontrol.com |
3600 |
rishikeshraftingcampingadventures.com | pdns10.domaincontrol.com |
3600 |
host | value | ttl |
---|---|---|
rishikeshraftingcampingadventures.com | Mname: pdns09.domaincontrol.com |
600 |
host | value | ttl |
---|---|---|
rishikeshraftingcampingadventures.com | Txt: google-site-verification=1X8f9BV0Ye_BZiCdF76dty9wLbO1OlZvS3pUFMkNXhs |
3600 |
rishikeshraftingcampingadventures.com | Txt: v=spf1 a mx ptr include:secureserver.net ~all |
3600 |
Safety
Compare it to ...Safety status of Rishikeshraftingcampingadventures.com is described as follows: Google Safe Browsing reports its status as safe.
MyWOT
Overall reputation | Unknown |
---|---|
Trustworthiness | Unknown |
Privacy | Unknown |
Child safety | Unknown |
Google Safe Browsing
Website status | Safe |
---|---|
Status | ok |
User reviews
Reputation | Unknown | |
---|---|---|
0 positive0 negative |
Social Engagement
Compare it to ...Rishikeshraftingcampingadventures.com has 0% of its total traffic coming from social networks (in last 3 months) and the most active engagement is detected in Facebook (2 shares)
Social Metrics Get more Rishikeshraftingcampingadventures.com social history
0%
of total traffic in last 3 months is social0
Facebook likes2
Facebook shares-
Twitter mentions0
Google pluses0
LinkedIn mentions0
Pinterest pins0
StumbleUpon views