Swiftcreekms.mychesterfieldschools.com
Visit swiftcreekms.mychesterfieldschools.comSwift Creek Middle School | Chesterfield County Public Schools
Global rank | 415 799 |
---|---|
Daily visitors | - |
Daily pageviews | - |
Pageviews per user | 0 |
Rating | |
---|---|
Status | Offline |
Latest check |
Countable Data Brief
Mychesterfieldschools.com is tracked by us since May, 2012. Over the time it has been ranked as high as 170 999 in the world, while most of its traffic comes from USA, where it reached as high as 22 486 position. Swiftcreekms.mychesterfieldschools.com receives less than 1% of its total traffic. All this time it was owned by Chip Cheatham of Chesterfield County Public Schools, it was hosted by Chesterfield County Public Schools. While WILD WEST DOMAINS LLC was its first registrar, now it is moved to Wild West Domains LLC.
Swiftcreekms.mychesterfieldschools has a mediocre Google pagerank and bad results in terms of Yandex topical citation index. We found that Swiftcreekms.mychesterfieldschools.com is poorly ‘socialized’ in respect to any social network. According to MyWot, Siteadvisor and Google safe browsing analytics, Swiftcreekms.mychesterfieldschools.com is quite a safe domain with no visitor reviews.
Worldwide Audience
Compare it to ...Mychesterfieldschools.com gets 100% of its traffic from USA where it is ranked #96938.
Top Countries
USA | 100.0% |
Top Ranks
USA | 96 938 |
Traffic Analysis
Compare it to ...It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.
Subdomains Traffic Shares
Swiftcreekms.mychesterfieldschools.com has no subdomains with considerable traffic.
SEO Stats
Compare it to ...Swiftcreekms.mychesterfieldschools.com has Google PR 2.
2
Google PR-
Yandex CYMetadata Updates Get more Swiftcreekms.mychesterfieldschools.com metadata updates
Homepage Top Backlinks PR
No data
Top Keywords % of search traffic
No data
Domain Registration Data
Compare it to ...Swiftcreekms.mychesterfieldschools.com domain is owned by Chip Cheatham Chesterfield County Public Schools and its registration expires in 2 months.
General Get more Mychesterfieldschools.com whois history
Chip Cheatham Chesterfield County Public Schools Owner since October 12, 2020 |
||
---|---|---|
2 months left Expires on June 23, 2024 |
12 years old Created on June 23, 2011 |
2 years ago Changed at June 21, 2021 |
Server Information
Compare it to ...Swiftcreekms.mychesterfieldschools.com is hosted by Chesterfield County Public Schools.
IP Whois Get more Swiftcreekms.mychesterfieldschools.com server history
-
Chesterfield County Public Schools
-
208.0.238.36
IP address
Server Technologies
-
Internet Information Services
Backend server
DNS Records
Nameservers
No data
host | value | ttl |
---|---|---|
swiftcreekms.mychesterfieldschools.com | 208.0.238.36 |
3600 |
Safety
Compare it to ...Safety status of Swiftcreekms.mychesterfieldschools.com is described as follows: MyWOT reports its overall reputation as good and Google Safe Browsing reports its status as safe.
MyWOT
Overall reputation | Good |
---|---|
Trustworthiness | Good |
Privacy | Good |
Child safety | Excellent |
Google Safe Browsing
Website status | Safe |
---|---|
Status | ok |
User reviews
Reputation | Unknown | |
---|---|---|
0 positive0 negative |
Social Engagement
Compare it to ...It seems Swiftcreekms.mychesterfieldschools.com has no mentions in social networks.