Swiftcreekms.mychesterfieldschools.com

Visit swiftcreekms.mychesterfieldschools.com

Swift Creek Middle School | Chesterfield County Public Schools

Global rank 415 799
Daily visitors -
Daily pageviews -
Pageviews per user 0
Rating
Status Offline
Latest check

Countable Data Brief

Mychesterfieldschools.com is tracked by us since May, 2012. Over the time it has been ranked as high as 170 999 in the world, while most of its traffic comes from USA, where it reached as high as 22 486 position. Swiftcreekms.mychesterfieldschools.com receives less than 1% of its total traffic. All this time it was owned by Chip Cheatham of Chesterfield County Public Schools, it was hosted by Chesterfield County Public Schools. While WILD WEST DOMAINS LLC was its first registrar, now it is moved to Wild West Domains LLC.

Swiftcreekms.mychesterfieldschools has a mediocre Google pagerank and bad results in terms of Yandex topical citation index. We found that Swiftcreekms.mychesterfieldschools.com is poorly ‘socialized’ in respect to any social network. According to MyWot, Siteadvisor and Google safe browsing analytics, Swiftcreekms.mychesterfieldschools.com is quite a safe domain with no visitor reviews.

Traffic Analysis

Compare it to ...

It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.

Subdomains Traffic Shares

Swiftcreekms.mychesterfieldschools.com has no subdomains with considerable traffic.

SEO Stats

Compare it to ...

Swiftcreekms.mychesterfieldschools.com has Google PR 2.

Ranks

2

Google PR

-

Yandex CY

Top Keywords % of search traffic

No data

Domain Registration Data

Compare it to ...

Swiftcreekms.mychesterfieldschools.com domain is owned by Chip Cheatham Chesterfield County Public Schools and its registration expires in 2 months.

General Get more Mychesterfieldschools.com whois history

Chip Cheatham Chesterfield County Public Schools

Owner since October 12, 2020

2 months left

Expires on June 23, 2024

12 years old

Created on June 23, 2011

2 years ago

Changed at June 21, 2021

Server Information

Compare it to ...

Swiftcreekms.mychesterfieldschools.com is hosted by Chesterfield County Public Schools.

IP Whois Get more Swiftcreekms.mychesterfieldschools.com server history

  • Chesterfield County Public Schools

  • 208.0.238.36

    IP address

Server Technologies

  • Internet Information Services

    Backend server

DNS Records

Nameservers

No data

host value ttl
swiftcreekms.mychesterfieldschools.com

208.0.238.36

3600

Safety status of Swiftcreekms.mychesterfieldschools.com is described as follows: MyWOT reports its overall reputation as good and Google Safe Browsing reports its status as safe.

MyWOT

Overall reputation Good
Trustworthiness Good
Privacy Good
Child safety Excellent

Google Safe Browsing

Website status Safe
Status ok

User reviews

Reputation Unknown

0

negative