easycounter

Onemainfinancialrewards.affinityperks.com

Visit onemainfinancialrewards.affinityperks.com

OneMain Rewards

Show more
Global rank

-

Daily visitors -
Daily pageviews -
Pageviews per user 0
Rating
Latest check

Countable Data Brief

Affinityperks.com is tracked by us since April, 2011. Over the time it has been ranked as high as 212 699 in the world, while most of its traffic comes from USA, where it reached as high as 33 508 position. Onemainfinancialrewards.affinityperks.com receives less than 1% of its total traffic. It was hosted by Next Jump Inc., Akamai Technologies Inc. and others. While GODADDY.COM LLC was its first registrar, now it is moved to GoDaddy.com LLC.

Onemainfinancialrewards.affinityperks has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Onemainfinancialrewards.affinityperks.com is poorly ‘socialized’ in respect to any social network. According to Siteadvisor and Google safe browsing analytics, Onemainfinancialrewards.affinityperks.com is quite a safe domain with no visitor reviews.

Worldwide Audience

Affinityperks.com gets 100% of its traffic from USA where it is ranked #174748.

Top Countries

USA 100.0%

Top Ranks

USA 174 748

Traffic Analysis

It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.

Subdomains Traffic Shares

Onemainfinancialrewards.affinityperks.com has no subdomains with considerable traffic.

SEO Stats

Onemainfinancialrewards.affinityperks.com is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.

Ranks

0

Google PR

-

Yandex CY

Homepage Top Backlinks PR
marmainc.blogspot.com 0
Top Keywords

% of search traffic

No data

Domain Registration Data

Onemainfinancialrewards.affinityperks.com domain is owned by Registration Private Domains By Proxy, LLC and its registration expires in 9 months.

  • Registration Private Domains By Proxy, LLC

    Owner since July 01, 2022

  • 9 months left

    Expires on March 02, 2025

  • 18 years old

    Created on January 12, 2006

  • 1 year ago

    Changed at March 02, 2023

In Other TLDs

No data

Social Engagement

It seems Onemainfinancialrewards.affinityperks.com has no mentions in social networks.

Server Information

Onemainfinancialrewards.affinityperks.com is hosted by Akamai Technologies, Inc.

Akamai Technologies, Inc.

184.28.213.221

IP address

Server technologies

  • Apache HTTP Server

    Backend server

DNS Records

  • Host

    onemainfinancialrewards.affinityperks.com

    Value

    184.28.213.221

    ttl

    13

Nameservers

No data

Safety

Safety status of Onemainfinancialrewards.affinityperks.com is described as follows: Google Safe Browsing reports its status as safe.

MyWOT

Overall reputation Unknown
Trustworthiness Unknown
Privacy Unknown
Child safety Unknown

Google Safe Browsing

Website status Safe
Status ok

User reviews

Reputation Unknown

0

Positive

0

Negative

Recently analyzed sites