Srisubrahmanyaswamydevalayamskandagiri.org

Countable Data Brief

Srisubrahmanyaswamydevalayamskandagiri.org is tracked by us since December, 2015. Over the time it has been ranked as high as 839 099 in the world, while most of its traffic comes from India, where it reached as high as 81 982 position. All this time it was owned by Outline Designs of Outline Designs, it was hosted by Webzilla B.V., Webzilla (AP region) and others.

Srisubrahmanyaswamydevalayamskandagiri has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Srisubrahmanyaswamydevalayamskandagiri.org is poorly ‘socialized’ in respect to any social network. According to Google safe browsing analytics, Srisubrahmanyaswamydevalayamskandagiri.org is quite a safe domain with no visitor reviews.

Traffic Analysis

Srisubrahmanyaswamydevalayamskandagiri.org has 694 visitors and 694 pageviews daily.

SEO Stats

Srisubrahmanyaswamydevalayamskandagiri.org is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.

Social Engagement

Srisubrahmanyaswamydevalayamskandagiri.org has 0% of its total traffic coming from social networks (in last 3 months) and the most active engagement is detected in Facebook (33 shares)

Safety

Safety status of Srisubrahmanyaswamydevalayamskandagiri.org is described as follows: Google Safe Browsing reports its status as safe.