easycounter

Swiftcreekms.mychesterfieldschools.com

Visit swiftcreekms.mychesterfieldschools.com

Swift Creek Middle School | Chesterfield County Public Schools

Show more
Global rank

425 399

Daily visitors -
Daily pageviews -
Pageviews per user 0
Rating
Latest check

Countable Data Brief

Mychesterfieldschools.com is tracked by us since May, 2012. Over the time it has been ranked as high as 170 999 in the world, while most of its traffic comes from USA, where it reached as high as 22 486 position. Swiftcreekms.mychesterfieldschools.com receives less than 1% of its total traffic. All this time it was owned by Chip Cheatham of Chesterfield County Public Schools, it was hosted by Chesterfield County Public Schools. While WILD WEST DOMAINS LLC was its first registrar, now it is moved to Wild West Domains LLC.

Swiftcreekms.mychesterfieldschools has a mediocre Google pagerank and bad results in terms of Yandex topical citation index. We found that Swiftcreekms.mychesterfieldschools.com is poorly ‘socialized’ in respect to any social network. According to MyWot, Siteadvisor and Google safe browsing analytics, Swiftcreekms.mychesterfieldschools.com is quite a safe domain with no visitor reviews.

Worldwide Audience

Mychesterfieldschools.com gets 100% of its traffic from USA where it is ranked #96938.

Top Countries

USA 100.0%

Top Ranks

USA 96 938

Traffic Analysis

It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.

Subdomains Traffic Shares

Swiftcreekms.mychesterfieldschools.com has no subdomains with considerable traffic.

SEO Stats

Swiftcreekms.mychesterfieldschools.com has Google PR 2.

Ranks

2

Google PR

-

Yandex CY

Homepage Top Backlinks PR
No data
Top Keywords

% of search traffic

No data

Domain Registration Data

Swiftcreekms.mychesterfieldschools.com domain is owned by Chip Cheatham Chesterfield County Public Schools and its registration expires in 1 month.

  • Chip Cheatham Chesterfield County Public Schools

    Owner since October 12, 2020

  • 1 month left

    Expires on June 23, 2024

  • 12 years old

    Created on June 23, 2011

  • 2 years ago

    Changed at June 21, 2021

In Other TLDs

No data

Social Engagement

It seems Swiftcreekms.mychesterfieldschools.com has no mentions in social networks.

Server Information

Swiftcreekms.mychesterfieldschools.com is hosted by Chesterfield County Public Schools.

Chesterfield County Public Schools

208.0.238.36

IP address

Server technologies

  • Internet Information Services

    Backend server

DNS Records

  • Host

    swiftcreekms.mychesterfieldschools.com

    Value

    208.0.238.36

    ttl

    3600

Nameservers

No data

Safety

Safety status of Swiftcreekms.mychesterfieldschools.com is described as follows: MyWOT reports its overall reputation as good and Google Safe Browsing reports its status as safe.

MyWOT

Overall reputation Good
Trustworthiness Good
Privacy Good
Child safety Excellent

Google Safe Browsing

Website status Safe
Status ok

User reviews

Reputation Unknown

0

Positive

0

Negative

Recently analyzed sites