{{text}}
Global rank | 425 399 |
---|---|
Daily visitors | - |
Daily pageviews | - |
Pageviews per user | 0 |
Rating | |
---|---|
Latest check |
Mychesterfieldschools.com is tracked by us since May, 2012. Over the time it has been ranked as high as 170 999 in the world, while most of its traffic comes from USA, where it reached as high as 22 486 position. Swiftcreekms.mychesterfieldschools.com receives less than 1% of its total traffic. All this time it was owned by Chip Cheatham of Chesterfield County Public Schools, it was hosted by Chesterfield County Public Schools. While WILD WEST DOMAINS LLC was its first registrar, now it is moved to Wild West Domains LLC.
Swiftcreekms.mychesterfieldschools has a mediocre Google pagerank and bad results in terms of Yandex topical citation index. We found that Swiftcreekms.mychesterfieldschools.com is poorly ‘socialized’ in respect to any social network. According to MyWot, Siteadvisor and Google safe browsing analytics, Swiftcreekms.mychesterfieldschools.com is quite a safe domain with no visitor reviews.
Mychesterfieldschools.com gets 100% of its traffic from USA where it is ranked #96938.
Top Countries
|
100.0% |
Top Ranks
|
96 938 |
It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.
Swiftcreekms.mychesterfieldschools.com has no subdomains with considerable traffic.
Swiftcreekms.mychesterfieldschools.com has Google PR 2.
Ranks
2
Google PR
-
Yandex CY
Homepage Top Backlinks | PR |
---|---|
No data |
Metadata Updates
Get more Swiftcreekms.mychesterfieldschools.com metadata updates
{{text}}
Top Keywords | % of search traffic |
---|---|
No data |
Swiftcreekms.mychesterfieldschools.com domain is owned by Chip Cheatham Chesterfield County Public Schools and its registration expires in 1 month.
General
Get more Swiftcreekms.mychesterfieldschools.com whois history
Chip Cheatham Chesterfield County Public Schools
Owner since October 12, 2020
1 month left
Expires on June 23, 2024
12 years old
Created on June 23, 2011
2 years ago
Changed at June 21, 2021
In Other TLDs
No data
It seems Swiftcreekms.mychesterfieldschools.com has no mentions in social networks.
Swiftcreekms.mychesterfieldschools.com is hosted by Chesterfield County Public Schools.
IP Whois
Get more Swiftcreekms.mychesterfieldschools.com server history
Chesterfield County Public Schools
208.0.238.36
IP address
Server technologies
Internet Information Services
Backend server
DNS Records
Host
swiftcreekms.mychesterfieldschools.com
Value
208.0.238.36
ttl
3600
Nameservers
No data
Safety status of Swiftcreekms.mychesterfieldschools.com is described as follows: MyWOT reports its overall reputation as good and Google Safe Browsing reports its status as safe.
MyWOT
Overall reputation | Good |
---|---|
Trustworthiness | Good |
Privacy | Good |
Child safety | Excellent |
Google Safe Browsing
Website status | Safe |
---|---|
Status | ok |
User reviews
Reputation | Unknown |
---|
0
Positive0
NegativeRecently analyzed sites