Tampaflcriminaldefenselawyers.com

Visit tampaflcriminaldefenselawyers.com

Tampa Criminal Defense Attorney | Over 25+ Years of Experience

http://tampaflcriminaldefenselawyers.com

Status

Online

Global rank	-
Daily visitors	1.39K
Daily pageviews	1.39K
Pageviews per user	1

Rating
Latest check	1 month ago

Countable Data Brief

Tampaflcriminaldefenselawyers.com is tracked by us since December, 2016. Over the time it has been ranked as high as 3 928 243 in the world. It was hosted by Affinity Internet Inc, Akamai Technologies Inc. and others. While GODADDY.COM LLC was its first registrar, now it is moved to GoDaddy.com LLC.

Tampaflcriminaldefenselawyers has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Tampaflcriminaldefenselawyers.com is poorly ‘socialized’ in respect to any social network. According to Siteadvisor and Google safe browsing analytics, Tampaflcriminaldefenselawyers.com is quite a safe domain with no visitor reviews.

Worldwide Audience

It seems that traffic on this site is too low to be displayed, sorry.

Compare it to ...

Traffic Analysis

Tampaflcriminaldefenselawyers.com has 1.39K visitors and 1.39K pageviews daily.

Compare it to ...

Pageviews

Subdomains Traffic Shares

Tampaflcriminaldefenselawyers.com has no subdomains with considerable traffic.

SEO Stats

Tampaflcriminaldefenselawyers.com is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.

Compare it to ...

Ranks

Google PR

Yandex CY

Homepage Top Backlinks	PR
thlmobilemall.com	1
andrewluckelitejerseys.com	0
becomeinked.com	0
doomagon.com	0
rtpteamx.blogspot.com	0

Metadata Updates

Get more Tampaflcriminaldefenselawyers.com metadata updates

Top Keywords	% of search traffic
criminal defense attorney	26.80%
florida expungement requirements	15.52%
stand your ground law florida statute	11.09%
florida statute stand your ground	4.16%

Domain Registration Data

Tampaflcriminaldefenselawyers.com domain is owned by Registration Private Domains By Proxy, LLC and its registration expires in 6 months.

Compare it to ...

General

Get more Tampaflcriminaldefenselawyers.com whois history

Registration Private Domains By Proxy, LLC

Owner since July 21, 2022
6 months ago

Expires on November 08, 2023
13 years old

Created on November 08, 2010
3 years ago

Changed at November 09, 2020

Registrar and Status

Registar

GODADDY.COM, LLC

Status

clientDeleteProhibited

clientRenewProhibited

clientTransferProhibited

clientUpdateProhibited

In Other TLDs

No data

Social Engagement

Tampaflcriminaldefenselawyers.com has 0% of its total traffic coming from social networks (in last 3 months) and the most active engagement is detected in Facebook (1 like)

Compare it to ...

Social Metrics

Get more Tampaflcriminaldefenselawyers.com social history

of total traffic in last 3 months is social