easycounter

Turningleafmarketing.viewscreencasts.com

Visit turningleafmarketing.viewscreencasts.com

Screenr Business > Log On

Show more
Global rank

-

Daily visitors -
Daily pageviews -
Pageviews per user 0
Rating
Latest check

Countable Data Brief

Viewscreencasts.com is tracked by us since May, 2012. Over the time it has been ranked as high as 125 099 in the world, while most of its traffic comes from USA, where it reached as high as 86 835 position. Turningleafmarketing.viewscreencasts.com receives less than 1% of its total traffic. It was owned by several entities, from Articulate to On behalf of viewscreencasts.com owner of Identity Protection Service, it was hosted by Microsoft Corp and Microsoft Corporation. While GODADDY.COM LLC was its first registrar, now it is moved to Amazon Registrar Inc..

Turningleafmarketing.viewscreencasts has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Turningleafmarketing.viewscreencasts.com is poorly ‘socialized’ in respect to any social network. According to Siteadvisor and Google safe browsing analytics, Turningleafmarketing.viewscreencasts.com is quite a safe domain with no visitor reviews.

Worldwide Audience

Viewscreencasts.com gets 35.3% of its traffic from USA where it is ranked #1277716.

Top Countries

USA 35.3%

Top Ranks

USA 1 277 716

Traffic Analysis

It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.

Subdomains Traffic Shares

Turningleafmarketing.viewscreencasts.com has no subdomains with considerable traffic.

SEO Stats

Turningleafmarketing.viewscreencasts.com is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.

Ranks

0

Google PR

-

Yandex CY

Homepage Top Backlinks PR
No data
Top Keywords

% of search traffic

No data

Domain Registration Data

Turningleafmarketing.viewscreencasts.com domain is owned by On behalf of viewscreencasts.com owner Identity Protection Service and its registration expires in 3 months.

  • On behalf of viewscreencasts.com owner Identity Protection Service

    Owner since August 26, 2023

  • 3 months ago

    Expires on February 05, 2024

  • 14 years old

    Created on February 05, 2010

  • 1 year ago

    Changed at January 08, 2023

In Other TLDs

No data

Social Engagement

It seems Turningleafmarketing.viewscreencasts.com has no mentions in social networks.

Server Information

Turningleafmarketing.viewscreencasts.com is hosted by Microsoft Corporation.

Microsoft Corporation

65.52.5.84

IP address

Server technologies

  • Internet Information Services

    Backend server

DNS Records

  • Host

    turningleafmarketing.viewscreencasts.com

    Value

    65.52.5.84

    ttl

    60

Nameservers

  • ns-1465.awsdns-55.org
  • ns-1547.awsdns-01.co.uk
  • ns-218.awsdns-27.com
  • ns-872.awsdns-45.net

Safety

Safety status of Turningleafmarketing.viewscreencasts.com is described as follows: Google Safe Browsing reports its status as safe.

MyWOT

Overall reputation Unknown
Trustworthiness Unknown
Privacy Unknown
Child safety Unknown

Google Safe Browsing

Website status Safe
Status ok

User reviews

Reputation Unknown

0

Positive

0

Negative

Recently analyzed sites