{{text}}
Global rank | - |
---|---|
Daily visitors | - |
Daily pageviews | - |
Pageviews per user | 0 |
Rating | |
---|---|
Latest check |
Viewscreencasts.com is tracked by us since May, 2012. Over the time it has been ranked as high as 125 099 in the world, while most of its traffic comes from USA, where it reached as high as 86 835 position. Turningleafmarketing.viewscreencasts.com receives less than 1% of its total traffic. It was owned by several entities, from Articulate to On behalf of viewscreencasts.com owner of Identity Protection Service, it was hosted by Microsoft Corp and Microsoft Corporation. While GODADDY.COM LLC was its first registrar, now it is moved to Amazon Registrar Inc..
Turningleafmarketing.viewscreencasts has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Turningleafmarketing.viewscreencasts.com is poorly ‘socialized’ in respect to any social network. According to Siteadvisor and Google safe browsing analytics, Turningleafmarketing.viewscreencasts.com is quite a safe domain with no visitor reviews.
Viewscreencasts.com gets 35.3% of its traffic from USA where it is ranked #1277716.
Top Countries
|
35.3% |
Top Ranks
|
1 277 716 |
It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.
Turningleafmarketing.viewscreencasts.com has no subdomains with considerable traffic.
Turningleafmarketing.viewscreencasts.com is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.
Ranks
0
Google PR
-
Yandex CY
Homepage Top Backlinks | PR |
---|---|
No data |
Metadata Updates
Get more Turningleafmarketing.viewscreencasts.com metadata updates
{{text}}
Top Keywords | % of search traffic |
---|---|
No data |
Turningleafmarketing.viewscreencasts.com domain is owned by On behalf of viewscreencasts.com owner Identity Protection Service and its registration expires in 3 months.
General
Get more Turningleafmarketing.viewscreencasts.com whois history
On behalf of viewscreencasts.com owner Identity Protection Service
Owner since August 26, 2023
3 months ago
Expires on February 05, 2024
14 years old
Created on February 05, 2010
1 year ago
Changed at January 08, 2023
In Other TLDs
No data
It seems Turningleafmarketing.viewscreencasts.com has no mentions in social networks.
Turningleafmarketing.viewscreencasts.com is hosted by Microsoft Corporation.
IP Whois
Get more Turningleafmarketing.viewscreencasts.com server history
Microsoft Corporation
65.52.5.84
IP address
Server technologies
Internet Information Services
Backend server
DNS Records
Host
turningleafmarketing.viewscreencasts.com
Value
65.52.5.84
ttl
60
Host
turningleafmarketing.viewscreencasts.com
Value
viewscreencasts.cloudapp.net
ttl
900
Nameservers
Safety status of Turningleafmarketing.viewscreencasts.com is described as follows: Google Safe Browsing reports its status as safe.
MyWOT
Overall reputation | Unknown |
---|---|
Trustworthiness | Unknown |
Privacy | Unknown |
Child safety | Unknown |
Google Safe Browsing
Website status | Safe |
---|---|
Status | ok |
User reviews
Reputation | Unknown |
---|
0
Positive0
NegativeRecently analyzed sites