Happymahashivratriwishesimages.in
Visit happymahashivratriwishesimages.inHappy Mother's Day 2016, Wishes, Images, Pics, Messages, Greetings, Poems -
Global rank | - |
---|---|
Daily visitors | - |
Daily pageviews | - |
Pageviews per user | 0 |
Rating | |
---|---|
Status | Offline |
Latest check |
Countable Data Brief
Happymahashivratriwishesimages.in is tracked by us since May, 2016. Over the time it has been ranked as high as 563 665 in the world, while most of its traffic comes from India, where it reached as high as 34 752 position. All this time it was owned by honey thakur, it was hosted by A Small Orange LLC and GoDaddy.com LLC.
Happymahashivratriwishesimages has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Happymahashivratriwishesimages.in is poorly ‘socialized’ in respect to any social network. According to Google safe browsing analytics, Happymahashivratriwishesimages.in is quite a safe domain with no visitor reviews.
Worldwide Audience
Compare it to ...Happymahashivratriwishesimages.in gets 91.5% of its traffic from India where it is ranked #34752.
Top Countries
India | 91.5% | |
USA | 7.1% |
Top Ranks
India | 34 752 | |
USA | 668 558 |
Traffic Analysis
Compare it to ...It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.
Subdomains Traffic Shares
Happymahashivratriwishesimages.in has no subdomains with considerable traffic.
SEO Stats
Compare it to ...Happymahashivratriwishesimages.in is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.
0
Google PR-
Yandex CYMetadata Updates Get more Happymahashivratriwishesimages.in metadata updates
Homepage Top Backlinks PR
No data
Top Keywords % of search traffic
happy father s day poem in ehglish | 100.00% |
Domain Registration Data
Compare it to ...Happymahashivratriwishesimages.in domain is owned by Honey Thakur and its registration expires in 6 years.
General Get more Happymahashivratriwishesimages.in whois history
Honey Thakur Owner since May 01, 2016 |
||
---|---|---|
6 years ago Expired on February 24, 2018 |
8 years old Created on February 24, 2016 |
7 years ago Changed at March 08, 2017 |
Registrar and Status
Registar | INRegistry |
Sponsor | GoDaddy.com, LLC (R101-AFIN) |
Status |
AUTORENEWPERIOD CLIENT DELETE PROHIBITED CLIENT TRANSFER PROHIBITED CLIENT UPDATE PROHIBITED |
In Other TLDs
No data
Similar Domain Names
Server Information
Compare it to ...Happymahashivratriwishesimages.in uses WordPress CMS and is hosted by GoDaddy.com, LLC.
IP Whois Get more Happymahashivratriwishesimages.in server history
-
GoDaddy.com, LLC
-
184.168.221.45
IP address
Server Technologies
-
Nginx
Backend server -
WordPress
CMS
DNS Records
Nameservers
- ns47.domaincontrol.com
- ns48.domaincontrol.com
host | value | ttl |
---|---|---|
happymahashivratriwishesimages.in | 184.168.221.45 |
599 |
host | value | ttl | pri |
---|---|---|---|
happymahashivratriwishesimages.in | smtp.secureserver.net |
3599 | 0 |
happymahashivratriwishesimages.in | mailstore1.secureserver.net |
3599 | 10 |
host | value | ttl |
---|---|---|
happymahashivratriwishesimages.in | ns48.domaincontrol.com |
3599 |
happymahashivratriwishesimages.in | ns47.domaincontrol.com |
3599 |
host | value | ttl |
---|---|---|
happymahashivratriwishesimages.in | Mname: ns47.domaincontrol.com |
599 |
Safety
Compare it to ...Safety status of Happymahashivratriwishesimages.in is described as follows: Google Safe Browsing reports its status as safe.
MyWOT
Overall reputation | Unknown |
---|---|
Trustworthiness | Unknown |
Privacy | Unknown |
Child safety | Unknown |
Google Safe Browsing
Website status | Safe |
---|---|
Status | ok |
User reviews
Reputation | Unknown | |
---|---|---|
0 positive0 negative |
Social Engagement
Compare it to ...Happymahashivratriwishesimages.in has 0% of its total traffic coming from social networks (in last 3 months) and the most active engagement is detected in Facebook (11 shares)
Social Metrics Get more Happymahashivratriwishesimages.in social history
0%
of total traffic in last 3 months is social0
Facebook likes11
Facebook shares-
Twitter mentions0
Google pluses0
LinkedIn mentions0
Pinterest pins0
StumbleUpon views