Kayipilanivermek.com
Visit kayipilanivermek.comGlobal rank | - |
---|---|
Daily visitors | - |
Daily pageviews | - |
Pageviews per user | 0 |
Rating | |
---|---|
Status | Online |
Latest check |
Countable Data Brief
Kayipilanivermek.com is tracked by us since September, 2013. Over the time it has been ranked as high as 527 999 in the world, while most of its traffic comes from Turkey, where it reached as high as 11 796 position. It was owned by several entities, from for information purposes and to assist persons in Mehmet Gokmen to REDACTED FOR PRIVACY of REDACTED FOR PRIVACY, it was hosted by RIPE Network Coordination Centre, Makdos Bilisim Teknolojileri Sanayi Ticaret Limited Sirketi and others. While was its first registrar, now it is moved to Nics Telekomunikasyon A.S..
Kayipilanivermek has a decent Google pagerank and bad results in terms of Yandex topical citation index. We found that Kayipilanivermek.com is poorly ‘socialized’ in respect to any social network. According to Google safe browsing analytics, Kayipilanivermek.com is quite a safe domain with no visitor reviews.
Worldwide Audience
Compare it to ...Kayipilanivermek.com gets 100% of its traffic from Turkey where it is ranked #23378.
Top Countries
Turkey | 100.0% |
Top Ranks
Turkey | 23 378 |
Traffic Analysis
Compare it to ...It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.
Subdomains Traffic Shares
Kayipilanivermek.com has no subdomains with considerable traffic.
SEO Stats
Compare it to ...Kayipilanivermek.com has Google PR 3.
3
Google PR-
Yandex CYHomepage Top Backlinks PR
toplist724.tr.gg | 3 |
diplomakayipilani.blogspot.com | 0 |
gazeteilanvermekankara.blogspot.com | 0 |
gecicimezuniyetbelgesikayipilani.blogspot.com | 0 |
ogrencikimligikayipilanivermek.blogspot.com | 0 |
Top Keywords % of search traffic
No data
Domain Registration Data
Compare it to ...Kayipilanivermek.com domain is owned by REDACTED FOR PRIVACY and its registration expires in 3 months.
General Get more Kayipilanivermek.com whois history
REDACTED FOR PRIVACY Owner since December 19, 2023 |
||
---|---|---|
3 months left Expires on August 17, 2024 |
11 years old Created on August 17, 2012 |
8 months ago Changed at August 18, 2023 |
Registrar and Status
Registar | Nics Telekomunikasyon A.S. |
Sponsor | CIZGI TELEKOMUNIKASYON A.S - NATRO |
Status |
ok |
In Other TLDs
Similar Domain Names
Server Information
Compare it to ...Kayipilanivermek.com uses WordPress CMS and is hosted by Makdos Bilisim Teknolojileri Sanayi Ticaret Limited Sirketi.
IP Whois Get more Kayipilanivermek.com server history
-
Makdos Bilisim Teknolojileri Sanayi Ticaret Limited Sirketi
-
185.122.203.95
IP address
Server Technologies
-
Nginx
Backend server -
WordPress
CMS
DNS Records
Nameservers
- ns1.kayipilanivermek.com
- ns2.kayipilanivermek.com
host | value | ttl |
---|---|---|
kayipilanivermek.com | 185.122.203.95 |
600 |
host | value | ttl |
---|---|---|
kayipilanivermek.com | 600 |
host | value | ttl | pri |
---|---|---|---|
kayipilanivermek.com | mx.yandex.net |
21600 | 10 |
host | value | ttl |
---|---|---|
kayipilanivermek.com | ns2.kayipilanivermek.com |
86400 |
kayipilanivermek.com | ns1.kayipilanivermek.com |
86400 |
host | value | ttl |
---|---|---|
kayipilanivermek.com | Mname: kayipilanivermek.com |
86400 |
host | value | ttl |
---|---|---|
kayipilanivermek.com | Txt: v=spf1 redirect=_spf.yandex.net |
21600 |
Safety
Compare it to ...Safety status of Kayipilanivermek.com is described as follows: Google Safe Browsing reports its status as safe.
Get more Kayipilanivermek.com reviews
MyWOT
Overall reputation | Unknown |
---|---|
Trustworthiness | Unknown |
Privacy | Unknown |
Child safety | Unknown |
Google Safe Browsing
Website status | Safe |
---|---|
Status | ok |
User reviews
Reputation | Unknown | |
---|---|---|
0 positive0 negative |
Social Engagement
Compare it to ...Kayipilanivermek.com has 0% of its total traffic coming from social networks (in last 3 months) and the most active engagement is detected in Facebook (10 shares)
Social Metrics Get more Kayipilanivermek.com social history
0%
of total traffic in last 3 months is social0
Facebook likes10
Facebook shares1
Twitter mentions0
Google pluses0
LinkedIn mentions0
Pinterest pins0
StumbleUpon views