Kayserievdenevenakliyatfirmalari.com
Visit kayserievdenevenakliyatfirmalari.comGlobal rank | - |
---|---|
Daily visitors | - |
Daily pageviews | - |
Pageviews per user | 0 |
Rating | |
---|---|
Status | Online |
Latest check |
Countable Data Brief
Kayserievdenevenakliyatfirmalari.com is tracked by us since January, 2013. Over the time it has been ranked as high as 2 523 299 in the world, while most of its traffic comes from Turkey, where it reached as high as 57 166 position. It was owned by several entities, from +90.3123344496 to GDPR Masked of GDPR Masked, it was hosted by Confluence Networks Inc., GNET Internet Telekomunikasyon A.S. and others. While PDR LTD. D/B/A PUBLICDOMAINREGISTRY.COM was its first registrar, now it is moved to PDR Ltd. d/b/a PublicDomainRegistry.com.
Kayserievdenevenakliyatfirmalari has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Kayserievdenevenakliyatfirmalari.com is poorly ‘socialized’ in respect to any social network. According to Google safe browsing analytics, Kayserievdenevenakliyatfirmalari.com is quite a safe domain with no visitor reviews.
Worldwide Audience
Compare it to ...Kayserievdenevenakliyatfirmalari.com gets 100% of its traffic from Turkey where it is ranked #149638.
Top Countries
Turkey | 100.0% |
Top Ranks
Turkey | 149 638 |
Traffic Analysis
Compare it to ...It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.
Subdomains Traffic Shares
Kayserievdenevenakliyatfirmalari.com has no subdomains with considerable traffic.
SEO Stats
Compare it to ...Kayserievdenevenakliyatfirmalari.com is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.
0
Google PR-
Yandex CYHomepage Top Backlinks PR
No data
Top Keywords % of search traffic
kayseri evden eve nakliyat yorumlar | 40.74% |
kayseri evden eve nakliyat platformu | 11.52% |
kayseri emniyet evden eve nakliyat | 0.41% |
kayseri günlük asansör kiralama | 0.26% |
nakliyat firmaları | 0.11% |
Domain Registration Data
Compare it to ...Kayserievdenevenakliyatfirmalari.com domain is owned by GDPR Masked and its registration expires in 1 day.
General Get more Kayserievdenevenakliyatfirmalari.com whois history
GDPR Masked Owner since August 29, 2018 |
||
---|---|---|
1 day left Expires on May 02, 2024 |
8 years old Created on May 02, 2016 |
12 months ago Changed at May 03, 2023 |
Registrar and Status
Registar | PDR LTD. D/B/A PUBLICDOMAINREGISTRY.COM |
Status |
clientTransferProhibited |
In Other TLDs
No data
Server Information
Compare it to ...Kayserievdenevenakliyatfirmalari.com uses WordPress CMS and is hosted by GNET Internet Telekomunikasyon A.S.
IP Whois Get more Kayserievdenevenakliyatfirmalari.com server history
-
GNET Internet Telekomunikasyon A.S.
-
89.252.138.35
IP address
Server Technologies
-
WordPress
CMS
DNS Records
Nameservers
- ns1.guzelhosting.com
- ns11.guzelhosting.com
- ns12.guzelhosting.com
- ns2.guzelhosting.com
host | value | ttl |
---|---|---|
kayserievdenevenakliyatfirmalari.com | 104.247.165.211 |
300 |
host | value | ttl | pri |
---|---|---|---|
kayserievdenevenakliyatfirmalari.com | kayserievdenevenakliyatfirmalari.com |
14400 | 0 |
host | value | ttl |
---|---|---|
kayserievdenevenakliyatfirmalari.com | ns1.guzelhosting.com |
86400 |
kayserievdenevenakliyatfirmalari.com | ns12.guzelhosting.com |
86400 |
kayserievdenevenakliyatfirmalari.com | ns2.guzelhosting.com |
86400 |
kayserievdenevenakliyatfirmalari.com | ns11.guzelhosting.com |
86400 |
host | value | ttl |
---|---|---|
kayserievdenevenakliyatfirmalari.com | Mname: ns1.guzelhosting.com |
86400 |
host | value | ttl |
---|---|---|
kayserievdenevenakliyatfirmalari.com | Txt: v=spf1 +a +mx +ip4:104.247.165.210 ~all |
14400 |
Safety
Compare it to ...Safety status of Kayserievdenevenakliyatfirmalari.com is described as follows: Google Safe Browsing reports its status as safe.
MyWOT
Overall reputation | Unknown |
---|---|
Trustworthiness | Unknown |
Privacy | Unknown |
Child safety | Unknown |
Google Safe Browsing
Website status | Safe |
---|---|
Status | ok |
User reviews
Reputation | Unknown | |
---|---|---|
0 positive0 negative |
Social Engagement
Compare it to ...Kayserievdenevenakliyatfirmalari.com has 0% of its total traffic coming from social networks (in last 3 months) and the most active engagement is detected in Facebook (5 shares)
Social Metrics Get more Kayserievdenevenakliyatfirmalari.com social history
0%
of total traffic in last 3 months is social0
Facebook likes5
Facebook shares0
Twitter mentions0
Google pluses0
LinkedIn mentions0
Pinterest pins1
StumbleUpon views