Srisubrahmanyaswamydevalayamskandagiri.org is tracked by us since December, 2015. Over the time it has been ranked as high as 839 099 in the world, while most of its traffic comes from India, where it reached as high as 81 982 position. All this time it was owned by Outline Designs of Outline Designs, it was hosted by Webzilla B.V., Webzilla (AP region) and others.

Srisubrahmanyaswamydevalayamskandagiri has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Srisubrahmanyaswamydevalayamskandagiri.org is poorly ‘socialized’ in respect to any social network. According to Google safe browsing analytics, Srisubrahmanyaswamydevalayamskandagiri.org is quite a safe domain with no visitor reviews.