Tampaflcriminaldefenselawyers.com
Visit tampaflcriminaldefenselawyers.comTampa Criminal Defense Attorney | Over 25+ Years of Experience
Global rank | - |
---|---|
Daily visitors | 1.39K |
Daily pageviews | 1.39K |
Pageviews per user | 1 |
Rating | |
---|---|
Status | Online |
Latest check |
Countable Data Brief
Tampaflcriminaldefenselawyers.com is tracked by us since December, 2016. Over the time it has been ranked as high as 3 928 243 in the world. It was hosted by Affinity Internet Inc, Akamai Technologies Inc. and others. While GODADDY.COM LLC was its first registrar, now it is moved to GoDaddy.com LLC.
Tampaflcriminaldefenselawyers has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Tampaflcriminaldefenselawyers.com is poorly ‘socialized’ in respect to any social network. According to Siteadvisor and Google safe browsing analytics, Tampaflcriminaldefenselawyers.com is quite a safe domain with no visitor reviews.
Worldwide Audience
Compare it to ...It seems that traffic on this site is too low to be displayed, sorry.
Traffic Analysis
Compare it to ...Tampaflcriminaldefenselawyers.com has 1.39K visitors and 1.39K pageviews daily.
Pageviews
Subdomains Traffic Shares
Tampaflcriminaldefenselawyers.com has no subdomains with considerable traffic.
SEO Stats
Compare it to ...Tampaflcriminaldefenselawyers.com is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.
0
Google PR-
Yandex CYMetadata Updates Get more Tampaflcriminaldefenselawyers.com metadata updates
Homepage Top Backlinks PR
thlmobilemall.com | 1 |
andrewluckelitejerseys.com | 0 |
becomeinked.com | 0 |
doomagon.com | 0 |
rtpteamx.blogspot.com | 0 |
Top Keywords % of search traffic
criminal defense attorney | 26.80% |
florida expungement requirements | 15.52% |
stand your ground law florida statute | 11.09% |
florida statute stand your ground | 4.16% |
Domain Registration Data
Compare it to ...Tampaflcriminaldefenselawyers.com domain is owned by Registration Private Domains By Proxy, LLC and its registration expires in 5 months.
General Get more Tampaflcriminaldefenselawyers.com whois history
Registration Private Domains By Proxy, LLC Owner since July 21, 2022 |
||
---|---|---|
5 months ago Expired on November 08, 2023 |
13 years old Created on November 08, 2010 |
3 years ago Changed at November 09, 2020 |
Registrar and Status
Registar | GODADDY.COM, LLC |
Status |
clientDeleteProhibited clientRenewProhibited clientTransferProhibited clientUpdateProhibited |
In Other TLDs
No data
Server Information
Compare it to ...Tampaflcriminaldefenselawyers.com is hosted by Akamai Technologies, Inc.
IP Whois Get more Tampaflcriminaldefenselawyers.com server history
-
Akamai Technologies, Inc.
-
199.46.34.141
IP address
Server Technologies
-
Internet Information Services
Backend server
DNS Records
Nameservers
- ns53.domaincontrol.com
- ns54.domaincontrol.com
host | value | ttl |
---|---|---|
tampaflcriminaldefenselawyers.com | 15.197.142.173 |
298 |
tampaflcriminaldefenselawyers.com | 3.33.152.147 |
298 |
host | value | ttl | pri |
---|---|---|---|
tampaflcriminaldefenselawyers.com | smtp.secureserver.net |
300 | 0 |
tampaflcriminaldefenselawyers.com | mailstore1.secureserver.net |
300 | 10 |
host | value | ttl |
---|---|---|
tampaflcriminaldefenselawyers.com | ns54.domaincontrol.com |
300 |
tampaflcriminaldefenselawyers.com | ns53.domaincontrol.com |
300 |
host | value | ttl |
---|---|---|
tampaflcriminaldefenselawyers.com | Mname: ns53.domaincontrol.com |
300 |
Safety
Compare it to ...Safety status of Tampaflcriminaldefenselawyers.com is described as follows: Google Safe Browsing reports its status as safe.
MyWOT
Overall reputation | Unknown |
---|---|
Trustworthiness | Unknown |
Privacy | Unknown |
Child safety | Unknown |
Google Safe Browsing
Website status | Safe |
---|---|
Status | ok |
User reviews
Reputation | Unknown | |
---|---|---|
0 positive0 negative |
Social Engagement
Compare it to ...Tampaflcriminaldefenselawyers.com has 0% of its total traffic coming from social networks (in last 3 months) and the most active engagement is detected in Facebook (1 like)
Social Metrics Get more Tampaflcriminaldefenselawyers.com social history
0%
of total traffic in last 3 months is social1
Facebook likes1
Facebook shares-
Twitter mentions0
Google pluses0
LinkedIn mentions0
Pinterest pins0
StumbleUpon views