Turningleafmarketing.viewscreencasts.com
Visit turningleafmarketing.viewscreencasts.comScreenr Business > Log On
Global rank | - |
---|---|
Daily visitors | - |
Daily pageviews | - |
Pageviews per user | 0 |
Rating | |
---|---|
Status | Offline |
Latest check |
Countable Data Brief
Viewscreencasts.com is tracked by us since May, 2012. Over the time it has been ranked as high as 125 099 in the world, while most of its traffic comes from USA, where it reached as high as 86 835 position. Turningleafmarketing.viewscreencasts.com receives less than 1% of its total traffic. It was owned by several entities, from Articulate to On behalf of viewscreencasts.com owner of Identity Protection Service, it was hosted by Microsoft Corp and Microsoft Corporation. While GODADDY.COM LLC was its first registrar, now it is moved to Amazon Registrar Inc..
Turningleafmarketing.viewscreencasts has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Turningleafmarketing.viewscreencasts.com is poorly ‘socialized’ in respect to any social network. According to Siteadvisor and Google safe browsing analytics, Turningleafmarketing.viewscreencasts.com is quite a safe domain with no visitor reviews.
Worldwide Audience
Compare it to ...Viewscreencasts.com gets 35.3% of its traffic from USA where it is ranked #1277716.
Top Countries
USA | 35.3% |
Top Ranks
USA | 1 277 716 |
Traffic Analysis
Compare it to ...It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.
Subdomains Traffic Shares
Turningleafmarketing.viewscreencasts.com has no subdomains with considerable traffic.
SEO Stats
Compare it to ...Turningleafmarketing.viewscreencasts.com is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.
0
Google PR-
Yandex CYMetadata Updates Get more Turningleafmarketing.viewscreencasts.com metadata updates
Homepage Top Backlinks PR
No data
Top Keywords % of search traffic
No data
Domain Registration Data
Compare it to ...Turningleafmarketing.viewscreencasts.com domain is owned by On behalf of viewscreencasts.com owner Identity Protection Service and its registration expires in 2 months.
General Get more Viewscreencasts.com whois history
On behalf of viewscreencasts.com owner Identity Protection Service Owner since August 26, 2023 |
||
---|---|---|
2 months ago Expired on February 05, 2024 |
14 years old Created on February 05, 2010 |
1 year ago Changed at January 08, 2023 |
Server Information
Compare it to ...Turningleafmarketing.viewscreencasts.com is hosted by Microsoft Corporation.
IP Whois Get more Turningleafmarketing.viewscreencasts.com server history
-
Microsoft Corporation
-
65.52.5.84
IP address
Server Technologies
-
Internet Information Services
Backend server
DNS Records
Nameservers
- ns-1465.awsdns-55.org
- ns-1547.awsdns-01.co.uk
- ns-218.awsdns-27.com
- ns-872.awsdns-45.net
host | value | ttl |
---|---|---|
turningleafmarketing.viewscreencasts.com | 65.52.5.84 |
60 |
host | value | ttl |
---|---|---|
turningleafmarketing.viewscreencasts.com | viewscreencasts.cloudapp.net |
900 |
Safety
Compare it to ...Safety status of Turningleafmarketing.viewscreencasts.com is described as follows: Google Safe Browsing reports its status as safe.
MyWOT
Overall reputation | Unknown |
---|---|
Trustworthiness | Unknown |
Privacy | Unknown |
Child safety | Unknown |
Google Safe Browsing
Website status | Safe |
---|---|
Status | ok |
User reviews
Reputation | Unknown | |
---|---|---|
0 positive0 negative |
Social Engagement
Compare it to ...It seems Turningleafmarketing.viewscreencasts.com has no mentions in social networks.