Turningleafmarketing.viewscreencasts.com

Visit turningleafmarketing.viewscreencasts.com

Screenr Business > Log On

Global rank -
Daily visitors -
Daily pageviews -
Pageviews per user 0
Rating
Status Offline
Latest check

Countable Data Brief

Viewscreencasts.com is tracked by us since May, 2012. Over the time it has been ranked as high as 125 099 in the world, while most of its traffic comes from USA, where it reached as high as 86 835 position. Turningleafmarketing.viewscreencasts.com receives less than 1% of its total traffic. It was owned by several entities, from Articulate to On behalf of viewscreencasts.com owner of Identity Protection Service, it was hosted by Microsoft Corp and Microsoft Corporation. While GODADDY.COM LLC was its first registrar, now it is moved to Amazon Registrar Inc..

Turningleafmarketing.viewscreencasts has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Turningleafmarketing.viewscreencasts.com is poorly ‘socialized’ in respect to any social network. According to Siteadvisor and Google safe browsing analytics, Turningleafmarketing.viewscreencasts.com is quite a safe domain with no visitor reviews.

Traffic Analysis

Compare it to ...

It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.

Subdomains Traffic Shares

Turningleafmarketing.viewscreencasts.com has no subdomains with considerable traffic.

SEO Stats

Compare it to ...

Turningleafmarketing.viewscreencasts.com is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.

Ranks

0

Google PR

-

Yandex CY

Top Keywords % of search traffic

No data

Domain Registration Data

Compare it to ...

Turningleafmarketing.viewscreencasts.com domain is owned by On behalf of viewscreencasts.com owner Identity Protection Service and its registration expires in 2 months.

General Get more Viewscreencasts.com whois history

On behalf of viewscreencasts.com owner Identity Protection Service

Owner since August 26, 2023

2 months ago

Expired on February 05, 2024

14 years old

Created on February 05, 2010

1 year ago

Changed at January 08, 2023

Server Information

Compare it to ...

Turningleafmarketing.viewscreencasts.com is hosted by Microsoft Corporation.

IP Whois Get more Turningleafmarketing.viewscreencasts.com server history

  • Microsoft Corporation

  • 65.52.5.84

    IP address

Server Technologies

  • Internet Information Services

    Backend server

DNS Records

Nameservers

  • ns-1465.awsdns-55.org
  • ns-1547.awsdns-01.co.uk
  • ns-218.awsdns-27.com
  • ns-872.awsdns-45.net
host value ttl
turningleafmarketing.viewscreencasts.com

65.52.5.84

60
host value ttl
turningleafmarketing.viewscreencasts.com

viewscreencasts.cloudapp.net

900

Safety status of Turningleafmarketing.viewscreencasts.com is described as follows: Google Safe Browsing reports its status as safe.

MyWOT

Overall reputation Unknown
Trustworthiness Unknown
Privacy Unknown
Child safety Unknown

Google Safe Browsing

Website status Safe
Status ok

User reviews

Reputation Unknown

0

negative