Ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com
Visit ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.comUltra Slim System Review – Certified Way To Lose Weight
Global rank | 881 |
---|---|
Daily visitors | - |
Daily pageviews | - |
Pageviews per user | 0 |
Rating | |
---|---|
Status | Online |
Latest check |
Countable Data Brief
Yolasite.com is tracked by us since April, 2011. Over the time it has been ranked as high as 2 079 in the world, while most of its traffic comes from India, where it reached as high as 1 171 position. Ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com receives less than 1% of its total traffic. It was owned by several entities, from Domain Admin Yola Inc to Data protected not disclosed, it was hosted by Amazon.com Inc. and CloudFlare Inc.. While MARKMONITOR INC. was its first registrar, now it is moved to SafeNames Ltd..
Ultraslimsystemreviewcertifiedwaytoloseweight.yolasite has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com is poorly ‘socialized’ in respect to any social network. According to Google safe browsing analytics, Ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com is quite a safe domain with no visitor reviews.
Worldwide Audience
Compare it to ...Yolasite.com gets 44.6% of its traffic from India where it is ranked #18331.
Top Countries
India | 44.6% | |
USA | 13.8% | |
Pakistan | 7.9% | |
Macedonia | 2.4% | |
Kenya | 2.1% |
Top Ranks
Macedonia | 2 259 | |
Kenya | 6 482 | |
Pakistan | 15 162 | |
India | 18 331 | |
USA | 86 602 |
Traffic Analysis
Compare it to ...It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.
Subdomains Traffic Shares
Ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com has no subdomains with considerable traffic.
SEO Stats
Compare it to ...Ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.
0
Google PR-
Yandex CYMetadata Updates Get more Ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com metadata updates
Homepage Top Backlinks PR
No data
Top Keywords % of search traffic
No data
Domain Registration Data
Compare it to ...Ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com domain is owned by Data protected, not disclosed and its registration expires in 10 months.
General Get more Yolasite.com whois history
Data protected, not disclosed Owner since May 29, 2018 |
||
---|---|---|
10 months left Expires on April 06, 2025 |
16 years old Created on April 06, 2008 |
1 year ago Changed at May 01, 2023 |
Server Information
Compare it to ...Ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com is hosted by CloudFlare, Inc.
IP Whois Get more Ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com server history
-
CloudFlare, Inc.
-
104.18.43.151
IP address
Server Technologies
No data
DNS Records
Nameservers
- ns0.dnsmadeeasy.com
- ns1.dnsmadeeasy.com
- ns2.dnsmadeeasy.com
- ns3.dnsmadeeasy.com
- ns4.dnsmadeeasy.com
host | value | ttl |
---|---|---|
ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com | 104.18.43.151 |
300 |
ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com | 172.64.144.105 |
300 |
host | value | ttl |
---|---|---|
ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com | 300 | |
ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com | 300 |
Safety
Compare it to ...Safety status of Ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com is described as follows: Google Safe Browsing reports its status as safe.
MyWOT
Overall reputation | Unknown |
---|---|
Trustworthiness | Unknown |
Privacy | Unknown |
Child safety | Unknown |
Google Safe Browsing
Website status | Safe |
---|---|
Status | ok |
User reviews
Reputation | Unknown | |
---|---|---|
0 positive0 negative |
Social Engagement
Compare it to ...Ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com has 0% of its total traffic coming from social networks (in last 3 months) and the most active engagement is detected in Facebook (1 like)
Social Metrics Get more Ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com social history
0%
of total traffic in last 3 months is social1
Facebook likes1
Facebook shares0
Twitter mentions1
Google pluses0
LinkedIn mentions0
Pinterest pins0
StumbleUpon views