Ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com

Visit ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com

Ultra Slim System Review – Certified Way To Lose Weight

Global rank 881
Daily visitors -
Daily pageviews -
Pageviews per user 0
Rating
Status Online
Latest check

Countable Data Brief

Yolasite.com is tracked by us since April, 2011. Over the time it has been ranked as high as 2 079 in the world, while most of its traffic comes from India, where it reached as high as 1 171 position. Ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com receives less than 1% of its total traffic. It was owned by several entities, from Domain Admin Yola Inc to Data protected not disclosed, it was hosted by Amazon.com Inc. and CloudFlare Inc.. While MARKMONITOR INC. was its first registrar, now it is moved to SafeNames Ltd..

Ultraslimsystemreviewcertifiedwaytoloseweight.yolasite has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com is poorly ‘socialized’ in respect to any social network. According to Google safe browsing analytics, Ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com is quite a safe domain with no visitor reviews.

Traffic Analysis

Compare it to ...

It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.

Subdomains Traffic Shares

Ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com has no subdomains with considerable traffic.

SEO Stats

Compare it to ...

Ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.

Ranks

0

Google PR

-

Yandex CY

Top Keywords % of search traffic

No data

Domain Registration Data

Compare it to ...

Ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com domain is owned by Data protected, not disclosed and its registration expires in 10 months.

General Get more Yolasite.com whois history

Data protected, not disclosed

Owner since May 29, 2018

10 months left

Expires on April 06, 2025

16 years old

Created on April 06, 2008

1 year ago

Changed at May 01, 2023

Server Information

Compare it to ...

Ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com is hosted by CloudFlare, Inc.

IP Whois Get more Ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com server history

  • CloudFlare, Inc.

  • 104.18.43.151

    IP address

Server Technologies

No data

DNS Records

Nameservers

  • ns0.dnsmadeeasy.com
  • ns1.dnsmadeeasy.com
  • ns2.dnsmadeeasy.com
  • ns3.dnsmadeeasy.com
  • ns4.dnsmadeeasy.com
host value ttl
ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com

104.18.43.151

300
ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com

172.64.144.105

300
host value ttl
ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com

300
ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com

300

Safety status of Ultraslimsystemreviewcertifiedwaytoloseweight.yolasite.com is described as follows: Google Safe Browsing reports its status as safe.

MyWOT

Overall reputation Unknown
Trustworthiness Unknown
Privacy Unknown
Child safety Unknown

Google Safe Browsing

Website status Safe
Status ok

User reviews

Reputation Unknown

0

negative