easycounter

Abounddigitalmarketing.flywheelsites.com

Visit abounddigitalmarketing.flywheelsites.com

Abound Digital Marketing Agency | Just another WordPress site

Show more
Global rank

6 969

Daily visitors -
Daily pageviews -
Pageviews per user 0
Rating
Latest check

Countable Data Brief

Flywheelsites.com is tracked by us since October, 2013. Over the time it has been ranked as high as 10 649 in the world, while most of its traffic comes from USA, where it reached as high as 2 099 position. Abounddigitalmarketing.flywheelsites.com receives less than 2.96% of its total traffic. It was owned by several entities, from Contact Privacy Inc. Customer 0132366480 of Contact Privacy Inc. Customer 0132366480 to REDACTED FOR PRIVACY of REDACTED FOR PRIVACY While TUCOWS DOMAINS INC. was its first registrar, now it is moved to Tucows Domains Inc..

Abounddigitalmarketing.flywheelsites has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Abounddigitalmarketing.flywheelsites.com is poorly ‘socialized’ in respect to any social network. According to Siteadvisor and Google safe browsing analytics, Abounddigitalmarketing.flywheelsites.com is quite a safe domain with no visitor reviews.

Worldwide Audience

Flywheelsites.com gets 31.6% of its traffic from USA where it is ranked #10541.

Top Countries

USA 31.6%
India 21.4%
Canada 13.5%
Pakistan 8.8%
Bangladesh 3.2%

Top Ranks

Canada 2 325
Bangladesh 3 312
Pakistan 3 479
USA 10 541
India 13 346

Traffic Analysis

It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.

Subdomains Traffic Shares

Sacksparente.flywheelsites.com is the most popular subdomain of Flywheelsites.com with 8.31% of its total traffic.

SEO Stats

Abounddigitalmarketing.flywheelsites.com is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.

Domain Registration Data

Abounddigitalmarketing.flywheelsites.com domain is owned by REDACTED FOR PRIVACY and its registration expires in 3 months.

  • REDACTED FOR PRIVACY

    Owner since November 24, 2018

  • 3 months left

    Expires on September 29, 2024

  • 11 years old

    Created on September 29, 2012

  • 8 months ago

    Changed at September 28, 2023

In Other TLDs

No data

Social Engagement

It seems Abounddigitalmarketing.flywheelsites.com has no mentions in social networks.

Server Information

IP Whois

No data

Server technologies

No data

DNS Records

  • Host

    abounddigitalmarketing.flywheelsites.com

    Value

    66.175.211.92

    ttl

    299

Nameservers

No data

Safety

Safety status of Abounddigitalmarketing.flywheelsites.com is described as follows: Google Safe Browsing reports its status as safe.

MyWOT

Overall reputation Unknown
Trustworthiness Unknown
Privacy Unknown
Child safety Unknown

Google Safe Browsing

Website status Safe
Status ok

User reviews

Reputation Unknown

0

Positive

0

Negative

Recently analyzed sites