Abounddigitalmarketing.flywheelsites.com

Visit abounddigitalmarketing.flywheelsites.com

Abound Digital Marketing Agency | Just another WordPress site

Global rank 6 829
Daily visitors -
Daily pageviews -
Pageviews per user 0
Rating
Status Offline
Latest check

Countable Data Brief

Flywheelsites.com is tracked by us since October, 2013. Over the time it has been ranked as high as 10 649 in the world, while most of its traffic comes from USA, where it reached as high as 2 099 position. Abounddigitalmarketing.flywheelsites.com receives less than 2.96% of its total traffic. It was owned by several entities, from Contact Privacy Inc. Customer 0132366480 of Contact Privacy Inc. Customer 0132366480 to REDACTED FOR PRIVACY of REDACTED FOR PRIVACY While TUCOWS DOMAINS INC. was its first registrar, now it is moved to Tucows Domains Inc..

Abounddigitalmarketing.flywheelsites has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Abounddigitalmarketing.flywheelsites.com is poorly ‘socialized’ in respect to any social network. According to Siteadvisor and Google safe browsing analytics, Abounddigitalmarketing.flywheelsites.com is quite a safe domain with no visitor reviews.

Traffic Analysis

Compare it to ...

It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.

Subdomains Traffic Shares

Sacksparente.flywheelsites.com is the most popular subdomain of Flywheelsites.com with 8.31% of its total traffic.

This Subdomain

abounddigitalmarketing.flywheelsites.com

0%

SEO Stats

Compare it to ...

Abounddigitalmarketing.flywheelsites.com is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.

Domain Registration Data

Compare it to ...

Abounddigitalmarketing.flywheelsites.com domain is owned by REDACTED FOR PRIVACY and its registration expires in 4 months.

General Get more Flywheelsites.com whois history

REDACTED FOR PRIVACY

Owner since November 24, 2018

4 months left

Expires on September 29, 2024

11 years old

Created on September 29, 2012

7 months ago

Changed at September 28, 2023

Server Information

Compare it to ...

IP Whois

No data

Server Technologies

No data

DNS Records

Nameservers

No data

host value ttl
abounddigitalmarketing.flywheelsites.com

66.175.211.92

299

Safety status of Abounddigitalmarketing.flywheelsites.com is described as follows: Google Safe Browsing reports its status as safe.

MyWOT

Overall reputation Unknown
Trustworthiness Unknown
Privacy Unknown
Child safety Unknown

Google Safe Browsing

Website status Safe
Status ok

User reviews

Reputation Unknown

0

negative