Abounddigitalmarketing.flywheelsites.com
Visit abounddigitalmarketing.flywheelsites.comAbound Digital Marketing Agency | Just another WordPress site
Global rank | 6 829 |
---|---|
Daily visitors | - |
Daily pageviews | - |
Pageviews per user | 0 |
Rating | |
---|---|
Status | Offline |
Latest check |
Countable Data Brief
Flywheelsites.com is tracked by us since October, 2013. Over the time it has been ranked as high as 10 649 in the world, while most of its traffic comes from USA, where it reached as high as 2 099 position. Abounddigitalmarketing.flywheelsites.com receives less than 2.96% of its total traffic. It was owned by several entities, from Contact Privacy Inc. Customer 0132366480 of Contact Privacy Inc. Customer 0132366480 to REDACTED FOR PRIVACY of REDACTED FOR PRIVACY While TUCOWS DOMAINS INC. was its first registrar, now it is moved to Tucows Domains Inc..
Abounddigitalmarketing.flywheelsites has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Abounddigitalmarketing.flywheelsites.com is poorly ‘socialized’ in respect to any social network. According to Siteadvisor and Google safe browsing analytics, Abounddigitalmarketing.flywheelsites.com is quite a safe domain with no visitor reviews.
Worldwide Audience
Compare it to ...Flywheelsites.com gets 31.6% of its traffic from USA where it is ranked #10541.
Top Countries
USA | 31.6% | |
India | 21.4% | |
Canada | 13.5% | |
Pakistan | 8.8% | |
Bangladesh | 3.2% |
Top Ranks
Canada | 2 325 | |
Bangladesh | 3 312 | |
Pakistan | 3 479 | |
USA | 10 541 | |
India | 13 346 |
Traffic Analysis
Compare it to ...It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.
Subdomains Traffic Shares
Sacksparente.flywheelsites.com is the most popular subdomain of Flywheelsites.com with 8.31% of its total traffic.
Top Subdomains
sacksparente.flywheelsites.com | 8.31% | |
donorbox.flywheelsites.com | 3.12% | |
peacekeeperstraining2022.flywheelsites.com | 3.11% | |
haagglobal.flywheelsites.com | 2.96% | |
other | 34.06% |
This Subdomain
SEO Stats
Compare it to ...Abounddigitalmarketing.flywheelsites.com is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.
Domain Registration Data
Compare it to ...Abounddigitalmarketing.flywheelsites.com domain is owned by REDACTED FOR PRIVACY and its registration expires in 4 months.
General Get more Flywheelsites.com whois history
REDACTED FOR PRIVACY Owner since November 24, 2018 |
||
---|---|---|
4 months left Expires on September 29, 2024 |
11 years old Created on September 29, 2012 |
7 months ago Changed at September 28, 2023 |
Server Information
Compare it to ...IP Whois
No data
Server Technologies
No data
DNS Records
Nameservers
No data
host | value | ttl |
---|---|---|
abounddigitalmarketing.flywheelsites.com | 66.175.211.92 |
299 |
Safety
Compare it to ...Safety status of Abounddigitalmarketing.flywheelsites.com is described as follows: Google Safe Browsing reports its status as safe.
MyWOT
Overall reputation | Unknown |
---|---|
Trustworthiness | Unknown |
Privacy | Unknown |
Child safety | Unknown |
Google Safe Browsing
Website status | Safe |
---|---|
Status | ok |
User reviews
Reputation | Unknown | |
---|---|---|
0 positive0 negative |
Social Engagement
Compare it to ...It seems Abounddigitalmarketing.flywheelsites.com has no mentions in social networks.