3daysmasaimaracampingsafarispack.weebly.com
Visit 3daysmasaimaracampingsafarispack.weebly.com3 Days Masai Mara Camping Safaris Package - 3 Days Masai Mara Camping Safaris Package
Global rank | 94 |
---|---|
Daily visitors | - |
Daily pageviews | - |
Pageviews per user | 0 |
Rating | |
---|---|
Status | Offline |
Latest check |
Countable Data Brief
Weebly.com is tracked by us since April, 2011. Over the time it has been ranked as high as 209 in the world, while most of its traffic comes from USA, where it reached as high as 63 position. 3daysmasaimaracampingsafarispack.weebly.com receives less than 0.46% of its total traffic. It was owned by several entities, from Weebly Inc. Web Services () to Data protected not disclosed, it was hosted by Weebly Inc.. While REGISTER.COM INC. was its first registrar, now it is moved to SafeNames Ltd..
3daysmasaimaracampingsafarispack.weebly has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that 3daysmasaimaracampingsafarispack.weebly.com is poorly ‘socialized’ in respect to any social network. According to MyWot, Siteadvisor and Google safe browsing analytics, 3daysmasaimaracampingsafarispack.weebly.com is a fully trustworthy domain with no visitor reviews.
Worldwide Audience
Compare it to ...Weebly.com gets 30.6% of its traffic from USA where it is ranked #370.
Top Countries
USA | 30.6% | |
India | 14.1% | |
United Kingdom | 3.9% | |
Taiwan | 3.8% | |
Canada | 3.4% |
Top Ranks
Taiwan | 336 | |
Canada | 352 | |
USA | 370 | |
India | 426 | |
United Kingdom | 459 |
Traffic Analysis
Compare it to ...It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.
Subdomains Traffic Shares
Community.weebly.com is the most popular subdomain of Weebly.com with 0.67% of its total traffic.
Top Subdomains
weebly.com | 29.00% | |
community.weebly.com | 0.67% | |
nogiarea.weebly.com | 0.62% | |
dlci.weebly.com | 0.46% | |
other | 6.93% |
This Subdomain
SEO Stats
Compare it to ...3daysmasaimaracampingsafarispack.weebly.com is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.
0
Google PR-
Yandex CYMetadata Updates Get more 3daysmasaimaracampingsafarispack.weebly.com metadata updates
Homepage Top Backlinks PR
No data
Top Keywords % of search traffic
No data
Domain Registration Data
Compare it to ...3daysmasaimaracampingsafarispack.weebly.com domain is owned by Data protected, not disclosed and its registration expires in 10 months.
General Get more Weebly.com whois history
Data protected, not disclosed Owner since May 29, 2018 |
||
---|---|---|
10 months left Expires on March 29, 2025 |
18 years old Created on March 29, 2006 |
1 month ago Changed at March 29, 2024 |
Server Information
Compare it to ...3daysmasaimaracampingsafarispack.weebly.com is hosted by Weebly, Inc.
IP Whois Get more 3daysmasaimaracampingsafarispack.weebly.com server history
-
Weebly, Inc.
-
199.34.228.53
IP address
Server Technologies
-
Apache HTTP Server
Backend server
DNS Records
Nameservers
No data
host | value | ttl |
---|---|---|
3daysmasaimaracampingsafarispack.weebly.com | 199.34.228.53 |
899 |
3daysmasaimaracampingsafarispack.weebly.com | 199.34.228.54 |
899 |
host | value | ttl |
---|---|---|
3daysmasaimaracampingsafarispack.weebly.com | pages-wildcard.weebly.com |
21598 |
Safety
Compare it to ...Safety status of 3daysmasaimaracampingsafarispack.weebly.com is described as follows: MyWOT reports its overall reputation as excellent and Google Safe Browsing reports its status as safe.
MyWOT
Overall reputation | Excellent |
---|---|
Trustworthiness | Excellent |
Privacy | Excellent |
Child safety | Excellent |
Google Safe Browsing
Website status | Safe |
---|---|
Status | ok |
User reviews
Reputation | Unknown | |
---|---|---|
0 positive0 negative |
Social Engagement
Compare it to ...It seems 3daysmasaimaracampingsafarispack.weebly.com has no mentions in social networks.