Bcfarmersmarket.org
Visit bcfarmersmarket.orgHome - BCAFM
| Global rank | 511 499 |
|---|---|
| Daily visitors | - |
| Daily pageviews | - |
| Pageviews per user | 0 |
| Rating | |
|---|---|
| Status | Online |
| Latest check |
Countable Data Brief
Bcfarmersmarket.org is tracked by us since April, 2011. Over the time it has been ranked as high as 952 799 in the world, while most of its traffic comes from Canada, where it reached as high as 255 position. It was hosted by GoDaddy.com Inc, OVH Hosting Inc. and others.
Bcfarmersmarket has a high Google pagerank and bad results in terms of Yandex topical citation index. We found that Bcfarmersmarket.org is poorly ‘socialized’ in respect to any social network. According to MyWot and Google safe browsing analytics, Bcfarmersmarket.org is quite a safe domain with no visitor reviews.
Worldwide Audience
Compare it to ...Bcfarmersmarket.org gets 78% of its traffic from Canada where it is ranked #37268.
Top Countries
| Canada | 78.0% |
Top Ranks
| Canada | 37 268 |
Traffic Analysis
Compare it to ...It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.
Similar Traffic Stats
| rank | visitors / pageviews |
|---|---|
| 511497 |
cgws.com
1.04K / 1.04K |
| 511498 |
fileopen.com
5.48K / 5.48K |
| 511499 |
bcfarmersmarket.org
- / - |
Subdomains Traffic Shares
Bcfarmersmarket.org has no subdomains with considerable traffic.
SEO Stats
Compare it to ...Bcfarmersmarket.org has Google PR 5.
Homepage Top Backlinks PR
| eatlocal.org | 5 |
| afcm.ca | 0 |
| bcfarmersmarkettrail.com | 0 |
| eastridgefarms.ca | 0 |
| fortlangleyvillagefarmersmarket.org | 0 |
Top Keywords % of search traffic
No data
Domain Registration Data
Compare it to ...Bcfarmersmarket.org domain is owned by Registration Private Domains By Proxy, LLC and its registration expires in 3 months.
General Get more Bcfarmersmarket.org whois history
|
Registration Private Domains By Proxy, LLC Owner since January 20, 2017 |
||
|---|---|---|
|
3 months ago Expired on February 14, 2024 |
23 years old Created on February 14, 2001 |
2 years ago Changed at February 14, 2022 |
Registrar and Status
| Registar | Public Interest Registry |
| Sponsor | GODADDY.COM, LLC |
| Status |
clientDeleteProhibited clientRenewProhibited clientTransferProhibited clientUpdateProhibited |
In Other TLDs
No data
Server Information
Compare it to ...Bcfarmersmarket.org uses WordPress CMS and is hosted by OVH Hosting, Inc.
IP Whois Get more Bcfarmersmarket.org server history
-
OVH Hosting, Inc.
-
66.70.176.210
IP address
Server Technologies
-
Apache HTTP Server
Backend server -
WordPress
CMS
DNS Records
Nameservers
- ns51.domaincontrol.com
- ns52.domaincontrol.com
| host | value | ttl |
|---|---|---|
| bcfarmersmarket.org | 66.70.176.210 |
300 |
| host | value | ttl | pri |
|---|---|---|---|
| bcfarmersmarket.org | bcfarmersmarket-org.mail.protection.outlook.com |
300 | 0 |
| host | value | ttl |
|---|---|---|
| bcfarmersmarket.org | ns52.domaincontrol.com |
300 |
| bcfarmersmarket.org | ns51.domaincontrol.com |
300 |
| host | value | ttl |
|---|---|---|
| bcfarmersmarket.org | Mname: ns51.domaincontrol.com |
300 |
| host | value | ttl |
|---|---|---|
| bcfarmersmarket.org | Txt: google-site-verification=OHeK94mSqgp5x-0KD3anTh7vMckmILF0s-6EN26ETYI |
300 |
| bcfarmersmarket.org | Txt: google-site-verification=RJ8GSf92TkR4ZHWZhEaXenhTAlCYnZooB0tX9EHImF0 |
300 |
| bcfarmersmarket.org | Txt: MS=ms76047553 |
300 |
| bcfarmersmarket.org | Txt: v=verifydomain MS=9667547 |
300 |
| bcfarmersmarket.org | Txt: v=spf1 include:secureserver.net include:sendgrid.net -all |
300 |
Safety
Compare it to ...Safety status of Bcfarmersmarket.org is described as follows: MyWOT reports its overall reputation as good and Google Safe Browsing reports its status as safe.
Get more Bcfarmersmarket.org reviews
MyWOT
| Overall reputation | Good |
|---|---|
| Trustworthiness | Good |
| Privacy | Good |
| Child safety | Unknown |
Google Safe Browsing
| Website status | Safe |
|---|---|
| Status | ok |
User reviews
| Reputation | Unknown | |
|---|---|---|
|
0 positive0 negative |
||
Social Engagement
Compare it to ...Bcfarmersmarket.org has 0% of its total traffic coming from social networks (in last 3 months) and the most active engagement is detected in Facebook (545 shares)
Social Metrics Get more Bcfarmersmarket.org social history
0%
of total traffic in last 3 months is social0
Facebook likes545
Facebook shares13
Twitter mentions5
Google pluses8
LinkedIn mentions0
Pinterest pins125
StumbleUpon views