Dursunevdenevenakliyat.com
Visit dursunevdenevenakliyat.comGlobal rank | - |
---|---|
Daily visitors | - |
Daily pageviews | - |
Pageviews per user | 0 |
Rating | |
---|---|
Status | Online |
Latest check |
Countable Data Brief
Dursunevdenevenakliyat.com is tracked by us since February, 2012. Over the time it has been ranked as high as 1 069 799 in the world, while most of its traffic comes from Turkey, where it reached as high as 21 543 position. It was owned by several entities, from TeknoGelisim Registered through: Go Daddy to Domain Admin of Privacy Protect LLC (PrivacyProtect.org), it was hosted by WEBSITEWELCOME.COM, GNET Internet Telekomunikasyon A.S. and others. While GODADDY.COM LLC was its first registrar, now it is moved to PDR Ltd. d/b/a PublicDomainRegistry.com.
Dursunevdenevenakliyat has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Dursunevdenevenakliyat.com is poorly ‘socialized’ in respect to any social network. According to Google safe browsing analytics, Dursunevdenevenakliyat.com is quite a safe domain with no visitor reviews.
Worldwide Audience
Compare it to ...Dursunevdenevenakliyat.com gets 100% of its traffic from Turkey where it is ranked #21543.
Top Countries
Turkey | 100.0% |
Top Ranks
Turkey | 21 543 |
Traffic Analysis
Compare it to ...It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.
Subdomains Traffic Shares
Dursunevdenevenakliyat.com has no subdomains with considerable traffic.
SEO Stats
Compare it to ...Dursunevdenevenakliyat.com is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.
0
Google PR-
Yandex CYHomepage Top Backlinks PR
kayserievdenevenakliyatfirmalari.com | 0 |
Top Keywords % of search traffic
kayseri evden eve nakliyat | 38.33% |
kayseri evden eve | 0.94% |
kars evden eve nakliyat | |
bursa evden eve | |
evden eve |
Domain Registration Data
Compare it to ...Dursunevdenevenakliyat.com domain is owned by Domain Admin Privacy Protect, LLC (PrivacyProtect.org) and its registration expires in 1 year.
General Get more Dursunevdenevenakliyat.com whois history
Domain Admin Privacy Protect, LLC (PrivacyProtect.org) Owner since November 21, 2019 |
||
---|---|---|
1 year left Expires on October 12, 2025 |
5 years old Created on October 12, 2018 |
7 months ago Changed at September 30, 2023 |
Registrar and Status
Registar | PDR LTD. D/B/A PUBLICDOMAINREGISTRY.COM |
Status |
clientTransferProhibited |
In Other TLDs
No data
Similar Domain Names
Server Information
Compare it to ...Dursunevdenevenakliyat.com is hosted by GNET Internet Telekomunikasyon A.S.
IP Whois Get more Dursunevdenevenakliyat.com server history
-
GNET Internet Telekomunikasyon A.S.
-
89.252.186.67
IP address
Server Technologies
No data
DNS Records
Nameservers
- ns1.guzelhosting.com
- ns11.guzelhosting.com
- ns12.guzelhosting.com
- ns2.guzelhosting.com
host | value | ttl |
---|---|---|
dursunevdenevenakliyat.com | 89.252.186.67 |
300 |
host | value | ttl | pri |
---|---|---|---|
dursunevdenevenakliyat.com | dursunevdenevenakliyat.com |
300 | 0 |
host | value | ttl |
---|---|---|
dursunevdenevenakliyat.com | ns1.guzelhosting.com |
300 |
dursunevdenevenakliyat.com | ns2.guzelhosting.com |
300 |
dursunevdenevenakliyat.com | ns11.guzelhosting.com |
300 |
dursunevdenevenakliyat.com | ns12.guzelhosting.com |
300 |
host | value | ttl |
---|---|---|
dursunevdenevenakliyat.com | Mname: ns1.guzelhosting.com |
300 |
host | value | ttl |
---|---|---|
dursunevdenevenakliyat.com | Txt: google-site-verification=OV1m-z0X2hg_E5BJXh28c3xHBu4m1U7ZS9RGiA6yLVg |
300 |
dursunevdenevenakliyat.com | Txt: v=spf1 ip4:89.252.186.66 ip4:89.252.186.2 ip4:89.252.186.36 ip4:89.252.186.35 ip4:89.252.186.34 ip4:208.74.123.2 +a +mx ~all |
300 |
Safety
Compare it to ...Safety status of Dursunevdenevenakliyat.com is described as follows: Google Safe Browsing reports its status as safe.
Get more Dursunevdenevenakliyat.com reviews
MyWOT
Overall reputation | Unknown |
---|---|
Trustworthiness | Unknown |
Privacy | Unknown |
Child safety | Unknown |
Google Safe Browsing
Website status | Safe |
---|---|
Status | ok |
User reviews
Reputation | Unknown | |
---|---|---|
0 positive0 negative |
Social Engagement
Compare it to ...Dursunevdenevenakliyat.com has 0% of its total traffic coming from social networks (in last 3 months) and the most active engagement is detected in Facebook (1.62K shares)
Social Metrics Get more Dursunevdenevenakliyat.com social history
0%
of total traffic in last 3 months is social0
Facebook likes1.62K
Facebook shares1
Twitter mentions79
Google pluses7
LinkedIn mentions0
Pinterest pins1
StumbleUpon views