Obatalamipenyakitkankerserviks.wordpress.com
Visit obatalamipenyakitkankerserviks.wordpress.comGlobal rank | 24 |
---|---|
Daily visitors | - |
Daily pageviews | - |
Pageviews per user | 0 |
Rating | |
---|---|
Status | Online |
Latest check |
Countable Data Brief
Wordpress.com is tracked by us since April, 2011. Over the time it has been ranked as high as 15 in the world, while most of its traffic comes from USA, where it reached as high as 30 position. Obatalamipenyakitkankerserviks.wordpress.com receives less than 0.42% of its total traffic. It was owned by several entities, from Automattic Inc. Registered through: Go Daddy to Automattic Inc., it was hosted by Automattic Inc. While GODADDY.COM LLC was its first registrar, now it is moved to MarkMonitor Inc..
Obatalamipenyakitkankerserviks.wordpress has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Obatalamipenyakitkankerserviks.wordpress.com is poorly ‘socialized’ in respect to any social network. According to MyWot and Google safe browsing analytics, Obatalamipenyakitkankerserviks.wordpress.com is a fully trustworthy domain with no visitor reviews.
Worldwide Audience
Compare it to ...Wordpress.com gets 15.7% of its traffic from USA where it is ranked #116.
Top Countries
USA | 15.7% | |
India | 14.7% | |
Indonesia | 3.6% | |
Brazil | 3.6% | |
United Kingdom | 2.7% |
Top Ranks
Indonesia | 44 | |
India | 60 | |
Brazil | 87 | |
USA | 116 | |
United Kingdom | 120 |
Traffic Analysis
Compare it to ...It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.
Subdomains Traffic Shares
Public-api.wordpress.com is the most popular subdomain of Wordpress.com with 0.88% of its total traffic.
Top Subdomains
wordpress.com | 28.00% | |
public-api.wordpress.com | 0.88% | |
mylifebeforeyoudoujinshi.wordpress.com | 0.64% | |
peliculasyseries1080.wordpress.com | 0.42% | |
other | 9.28% |
This Subdomain
SEO Stats
Compare it to ...Obatalamipenyakitkankerserviks.wordpress.com is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.
0
Google PR-
Yandex CYHomepage Top Backlinks PR
No data
Top Keywords % of search traffic
No data
Domain Registration Data
Compare it to ...Obatalamipenyakitkankerserviks.wordpress.com domain is owned by Automattic, Inc. and its registration expires in 8 years.
General Get more Wordpress.com whois history
Automattic, Inc. Owner since May 29, 2018 |
||
---|---|---|
8 years left Expires on March 03, 2033 |
24 years old Created on March 03, 2000 |
8 months ago Changed at August 28, 2023 |
Server Information
Compare it to ...Obatalamipenyakitkankerserviks.wordpress.com uses WordPress CMS and is hosted by Automattic, Inc.
IP Whois Get more Obatalamipenyakitkankerserviks.wordpress.com server history
-
Automattic, Inc
-
192.0.78.12
IP address
Server Technologies
-
Nginx
Backend server -
WordPress
CMS
DNS Records
Nameservers
- ns1.wordpress.com
- ns2.wordpress.com
- ns3.wordpress.com
- ns4.wordpress.com
- ns5.wordpress.com
host | value | ttl |
---|---|---|
obatalamipenyakitkankerserviks.wordpress.com | 192.0.78.13 |
142 |
obatalamipenyakitkankerserviks.wordpress.com | 192.0.78.12 |
142 |
host | value | ttl |
---|---|---|
obatalamipenyakitkankerserviks.wordpress.com | lb.wordpress.com |
300 |
Safety
Compare it to ...Safety status of Obatalamipenyakitkankerserviks.wordpress.com is described as follows: MyWOT reports its overall reputation as excellent and Google Safe Browsing reports its status as safe.
MyWOT
Overall reputation | Excellent |
---|---|
Trustworthiness | Excellent |
Privacy | Excellent |
Child safety | Unknown |
Google Safe Browsing
Website status | Safe |
---|---|
Status | ok |
User reviews
Reputation | Unknown | |
---|---|---|
0 positive0 negative |
Social Engagement
Compare it to ...It seems Obatalamipenyakitkankerserviks.wordpress.com has no mentions in social networks.